PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC019116.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 415aa    MW: 45902.2 Da    PI: 6.8328
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC019116.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.61.8e-304696151
       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                  kprl+Wtp+LHerFveav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQ
  EcC019116.10 46 KPRLKWTPDLHERFVEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQ 96
                  79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-284496IPR009057Homeodomain-like
SuperFamilySSF466895.55E-144597IPR009057Homeodomain-like
TIGRFAMsTIGR015576.9E-204697IPR006447Myb domain, plants
PfamPF002492.5E-84896IPR001005SANT/Myb domain
PfamPF143792.6E-25145189IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MYHHNQHLGK NISPSSRMPI PSDRHMFIQG GNGPGDSGLV LSTDAKPRLK WTPDLHERFV  60
EAVNQLGGAD KATPKTVMKL MGIPGLTLYH LKSHLQXXXX XXXXXXXXXX XXXXXXXXXX  120
XXETNGSHVH NLNIVPQTNK NLPFGEALQM QIEVQRRLHE QLEVQRHLQL RIEAQGKYLQ  180
SVLEKAQETL GRQNVGSASL EATKLQLSEL VSKVSTQSLN SAFPDLKELQ GLCAQQIQTN  240
PPTDCSVDSC LTSCEGSHKD QEIHNNGIGL RPYSGGSVLL DPKGITDEPR TEKIEFKWGG  300
DLKEDRMFLS YGVKEMERSF PGGLGQGHLS MSIGLEGGLG CSEVKNKAKE VGGSVNFLER  360
LHSRADSVNM DSNQRSCGNQ LHYFEAKLDL NAREETDVAS SGKQFDLNGN GFGWG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036186.10.0PREDICTED: uncharacterized protein LOC104425247 isoform X1
TrEMBLA0A059A1W60.0A0A059A1W6_EUCGR; Uncharacterized protein
STRINGPOPTR_0013s05670.11e-161(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-135G2-like family protein